Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK13 Rabbit Polyclonal Antibody (FITC)

MAPK13 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SAPK4, PRKM13, MAPK 13, MAPK-13, p38delta

UniProt

Q9N272

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAPK13

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002745

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Protein Phosphatase 1 Regulatory Subunit 12B (PPP1R12B) ELISA Kit
MBS9916186-01 48 Well

Porcine Protein Phosphatase 1 Regulatory Subunit 12B (PPP1R12B) ELISA Kit

Sign In for Pricing
View Details
Porcine Protein Phosphatase 1 Regulatory Subunit 12B (PPP1R12B) ELISA Kit
MBS9916186-02 96 Well

Porcine Protein Phosphatase 1 Regulatory Subunit 12B (PPP1R12B) ELISA Kit

Sign In for Pricing
View Details
Porcine Protein Phosphatase 1 Regulatory Subunit 12B (PPP1R12B) ELISA Kit
MBS9916186-03 5x 96 Well

Porcine Protein Phosphatase 1 Regulatory Subunit 12B (PPP1R12B) ELISA Kit

Sign In for Pricing
View Details
Porcine Protein Phosphatase 1 Regulatory Subunit 12B (PPP1R12B) ELISA Kit
MBS9916186-04 10x 96 Well

Porcine Protein Phosphatase 1 Regulatory Subunit 12B (PPP1R12B) ELISA Kit

Sign In for Pricing
View Details
Phosphotyrosine (MaxLight 650) discontinued
P4075-30-ML650 100 µL

Phosphotyrosine (MaxLight 650) discontinued

Sign In for Pricing
View Details
LMAN1 Recombinant Rabbit mAb
BS46187-01 50 µL

LMAN1 Recombinant Rabbit mAb

Sign In for Pricing
View Details