Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK13 Rabbit Polyclonal Antibody (HRP)

MAPK13 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SAPK4, PRKM13, MAPK 13, MAPK-13, p38delta

UniProt

O15264

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAPK13

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KMLELDVDKRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002745

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human sFLT1 ELISA Kit
EHS0015 96 Tests

Human sFLT1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Monoclonal FoxP3 Antibody (FOXP3/8145R) [PerCP]
NBP3-20858PCP 0.1 mL

Rabbit Monoclonal FoxP3 Antibody (FOXP3/8145R) [PerCP]

Sign In for Pricing
View Details
HMX3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
23688154 3x 1.0 µg DNA

HMX3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
PEX16 (Peroxisomal Membrane Protein PEX16, Peroxin-16, Peroxisomal Biogenesis Factor 16)
131169 200 µL

PEX16 (Peroxisomal Membrane Protein PEX16, Peroxin-16, Peroxisomal Biogenesis Factor 16)

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri Glutamate-1-semialdehyde 2,1-aminomutase (hemL)
MBS1216685-01 0.02 mg (E-Coli)

Recombinant Arcobacter butzleri Glutamate-1-semialdehyde 2,1-aminomutase (hemL)

Sign In for Pricing
View Details
Recombinant Arcobacter butzleri Glutamate-1-semialdehyde 2,1-aminomutase (hemL)
MBS1216685-02 0.02 mg (Yeast)

Recombinant Arcobacter butzleri Glutamate-1-semialdehyde 2,1-aminomutase (hemL)

Sign In for Pricing
View Details