Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psma2 Rabbit Polyclonal Antibody (HRP)

Psma2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P17220

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Psma2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGK

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058975

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5- (Thiophen-2-yl) -7- (trifluoromethyl) -[1,3]thiazolo[4,5-b]pyridin-2-amine
TEB45327-01 0.5 g

5- (Thiophen-2-yl) -7- (trifluoromethyl) -[1,3]thiazolo[4,5-b]pyridin-2-amine

Sign In for Pricing
View Details
5- (Thiophen-2-yl) -7- (trifluoromethyl) -[1,3]thiazolo[4,5-b]pyridin-2-amine
TEB45327-02 5 g

5- (Thiophen-2-yl) -7- (trifluoromethyl) -[1,3]thiazolo[4,5-b]pyridin-2-amine

Sign In for Pricing
View Details
LOC100360297 3'UTR Luciferase Stable Cell Line
TU207513 1.0 mL

LOC100360297 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Hamster Dual Specificity Phosphatase 1 ELISA Kit
MBS066925-01 48 Well

Hamster Dual Specificity Phosphatase 1 ELISA Kit

Sign In for Pricing
View Details
Hamster Dual Specificity Phosphatase 1 ELISA Kit
MBS066925-02 96 Well

Hamster Dual Specificity Phosphatase 1 ELISA Kit

Sign In for Pricing
View Details
Hamster Dual Specificity Phosphatase 1 ELISA Kit
MBS066925-03 5x 96 Well

Hamster Dual Specificity Phosphatase 1 ELISA Kit

Sign In for Pricing
View Details