Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMB2 Rabbit Polyclonal Antibody (FITC)

PSMB2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HC7-I

UniProt

P49721

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PSMB2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002785

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXL17 Isoform 2 (F-box/LRR-Repeat Protein 17, F-box and Leucine-rich Repeat Protein 17, F-box only Protein 13, FBXL17, FBL17, FBX13, FBXO13) (MaxLight 750) discontinued
302440-ML750 100 µL

FBXL17 Isoform 2 (F-box/LRR-Repeat Protein 17, F-box and Leucine-rich Repeat Protein 17, F-box only Protein 13, FBXL17, FBL17, FBX13, FBXO13) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Porcine Olfactory receptor 10H2 (OR10H2) ELISA kit
GTR10462396 96 Well

Porcine Olfactory receptor 10H2 (OR10H2) ELISA kit

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 8 Receptor Beta (IL8Rb)
TRV-0057295-01 20 µL

Polyclonal Antibody to Interleukin 8 Receptor Beta (IL8Rb)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 8 Receptor Beta (IL8Rb)
TRV-0057295-02 100 µL

Polyclonal Antibody to Interleukin 8 Receptor Beta (IL8Rb)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 8 Receptor Beta (IL8Rb)
TRV-0057295-03 200 µL

Polyclonal Antibody to Interleukin 8 Receptor Beta (IL8Rb)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 8 Receptor Beta (IL8Rb)
TRV-0057295-04 1 mL

Polyclonal Antibody to Interleukin 8 Receptor Beta (IL8Rb)

Sign In for Pricing
View Details