Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMB2 Rabbit Polyclonal Antibody (HRP)

PSMB2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HC7-I

UniProt

P49721

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PSMB2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLD

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002785

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Anaphase-promoting complex subunit CDC26 (CDC26) ELISA Kit
MBS7234058-01 48 Well

Guinea pig Anaphase-promoting complex subunit CDC26 (CDC26) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anaphase-promoting complex subunit CDC26 (CDC26) ELISA Kit
MBS7234058-02 96 Well

Guinea pig Anaphase-promoting complex subunit CDC26 (CDC26) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anaphase-promoting complex subunit CDC26 (CDC26) ELISA Kit
MBS7234058-03 5x 96 Well

Guinea pig Anaphase-promoting complex subunit CDC26 (CDC26) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anaphase-promoting complex subunit CDC26 (CDC26) ELISA Kit
MBS7234058-04 10x 96 Well

Guinea pig Anaphase-promoting complex subunit CDC26 (CDC26) ELISA Kit

Sign In for Pricing
View Details
pGL3-Basic-CGA promoter Plasmid
PVTB80059-2a 2 µg

pGL3-Basic-CGA promoter Plasmid

Sign In for Pricing
View Details
CCNC Antibody
orb572213 100 µL

CCNC Antibody

Sign In for Pricing
View Details