Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMB10 Rabbit Polyclonal Antibody (HRP)

PSMB10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

LMP10, MECL1, PRAAS5, beta2i

UniProt

P40306

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PSMB10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002792

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chlamydia pneumonia IgG ELISA
MBS8579317-01 96 Tests

Chlamydia pneumonia IgG ELISA

Sign In for Pricing
View Details
Chlamydia pneumonia IgG ELISA
MBS8579317-02 5x 96 Tests

Chlamydia pneumonia IgG ELISA

Sign In for Pricing
View Details
MCAR1, NT (SLC25A51, MCART1, Solute carrier family 25 member 51, Mitochondrial carrier triple repeat protein 1) (APC) discontinued
038261-APC 200 µL

MCAR1, NT (SLC25A51, MCART1, Solute carrier family 25 member 51, Mitochondrial carrier triple repeat protein 1) (APC) discontinued

Sign In for Pricing
View Details
Recombinant Nitrosomonas eutropha Protease HtpX homolog (htpX)
orb2916016-01 20 µg

Recombinant Nitrosomonas eutropha Protease HtpX homolog (htpX)

Sign In for Pricing
View Details
Recombinant Nitrosomonas eutropha Protease HtpX homolog (htpX)
orb2916016-02 100 µg

Recombinant Nitrosomonas eutropha Protease HtpX homolog (htpX)

Sign In for Pricing
View Details
SR-1F Polyclonal Antibody
RA30020-01 50 µL

SR-1F Polyclonal Antibody

Sign In for Pricing
View Details