Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psmc1 Rabbit Polyclonal Antibody (Biotin)

Psmc1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S, S4, rp, P26, rpt2, P26s4, Rpt2/S4, AI325227

UniProt

P62192

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YLLMEEEFIRNQEQMKPLEEKQEEERSKVDDLRGTPMSVGTLEEIIDDNH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

PABPN1L Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV687621 1.0 µg DNA

PABPN1L Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
MDM2 Antibody
B1154-01 50 μL

MDM2 Antibody

Sign In for Pricing
View Details
MDM2 Antibody
B1154-02 100 µL

MDM2 Antibody

Sign In for Pricing
View Details
CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (MaxLight 550)
MBS6210787-01 0.1 mL

CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (MaxLight 550)

Sign In for Pricing
View Details
CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (MaxLight 550)
MBS6210787-02 5x 0.1 mL

CHEK2 (Serine/Threonine-protein Kinase Chk2, CHK2 Checkpoint Homolog, Cds1 Homolog, Hucds1, hCds1, Checkpoint Kinase 2, CDS1, CHK2, RAD53) (MaxLight 550)

Sign In for Pricing
View Details
Anti-NNP1 Antibody
MBS8307997-01 0.03 mL

Anti-NNP1 Antibody

Sign In for Pricing
View Details