Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psmc1 Rabbit Polyclonal Antibody (HRP)

Psmc1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, S4, rp, P26, rpt2, P26s4, Rpt2/S4, AI325227

UniProt

P62192

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Aquaporin 3, Gill Blood Group (AQP3) ELISA Kit
EKN51771 96 Tests

Rat Aquaporin 3, Gill Blood Group (AQP3) ELISA Kit

Sign In for Pricing
View Details
Rat Ccdc12 Pre-designed siRNA Set B
SI202078B 1 Each

Rat Ccdc12 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CD68 (MACROSIALIN, GP110, LAMP4, Scavenger Receptor Class D Member 1, SCARD1) (APC)
MBS6410415-01 0.1 mL

CD68 (MACROSIALIN, GP110, LAMP4, Scavenger Receptor Class D Member 1, SCARD1) (APC)

Sign In for Pricing
View Details
CD68 (MACROSIALIN, GP110, LAMP4, Scavenger Receptor Class D Member 1, SCARD1) (APC)
MBS6410415-02 5x 0.1 mL

CD68 (MACROSIALIN, GP110, LAMP4, Scavenger Receptor Class D Member 1, SCARD1) (APC)

Sign In for Pricing
View Details
Lentiviral mouse Gtf3c3 shRNA (UAS) - Lentiviral mouse Gtf3c3 shRNA (UAS, RFP) (25)
GTR15285635 1 Vial

Lentiviral mouse Gtf3c3 shRNA (UAS) - Lentiviral mouse Gtf3c3 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rat Cytochrome P450 1A1 ELISA Kit
MBS2881501-01 48 Well

Rat Cytochrome P450 1A1 ELISA Kit

Sign In for Pricing
View Details