Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psmc1 Rabbit Polyclonal Antibody (HRP)

Psmc1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S, S4, rp, P26, rpt2, P26s4, Rpt2/S4, AI325227

UniProt

P62192

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELFRVAEEHAPSIVFIDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) egd2 Polyclonal Antibody
MBS7140612 Inquire

Rabbit anti-Schizosaccharomyces pombe (strain 972/24843)(Fission yeast) egd2 Polyclonal Antibody

Sign In for Pricing
View Details
ELISA Kit For Chloride channel protein 1
E12789d 96 Tests

ELISA Kit For Chloride channel protein 1

Sign In for Pricing
View Details
FZR1 Antibody
CSB-PA845079XA01DOA-01 50 μL

FZR1 Antibody

Sign In for Pricing
View Details
FZR1 Antibody
CSB-PA845079XA01DOA-02 100 µL

FZR1 Antibody

Sign In for Pricing
View Details
MBD3 Lentiviral Activation Particles (h2)
sc-401072-LAC-2 200 µL

MBD3 Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Recombinant Escherichia coli Protein traX (traX), partial
MBS7060041 Inquire

Recombinant Escherichia coli Protein traX (traX), partial

Sign In for Pricing
View Details