Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD1 Rabbit Polyclonal Antibody (HRP)

PSMD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S1, P112, Rpn2

UniProt

Q99460

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002798

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHP2 Human qPCR Primer Pair (NM_022097)
HP214352 200 Reactions

CHP2 Human qPCR Primer Pair (NM_022097)

Sign In for Pricing
View Details
Goat Niemann-Pick C1-like protein 1 ELISA Kit
GTR10328707 96 Well

Goat Niemann-Pick C1-like protein 1 ELISA Kit

Sign In for Pricing
View Details
CACNA2D1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV658917 1.0 µg DNA

CACNA2D1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Rat Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit
EKN43481 96 Tests

Rat Angiopoietin Like Protein 2 (ANGPTL2) ELISA Kit

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Magnetic Fluorescence Assay Kit
MBS2155872-01 96 Tests

Cyclin D1 (CCND1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Magnetic Fluorescence Assay Kit
MBS2155872-02 5x 96 Tests

Cyclin D1 (CCND1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details