Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD1 Rabbit Polyclonal Antibody (HRP)

PSMD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S1, P112, Rpn2

UniProt

Q99460

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PSMD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

106kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002798

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Krt1 Mouse Pre-designed siRNA Set A
HY-RS19346 1 Set

Krt1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rat Anti-Mouse Ly-6G/Ly-6C mAb (FITC)
orb2710834 100 Tests

Rat Anti-Mouse Ly-6G/Ly-6C mAb (FITC)

Sign In for Pricing
View Details
Human Zinc finger protein 493, ZNF493 ELISA Kit
MBS9338203-01 48 Well

Human Zinc finger protein 493, ZNF493 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 493, ZNF493 ELISA Kit
MBS9338203-02 96 Well

Human Zinc finger protein 493, ZNF493 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 493, ZNF493 ELISA Kit
MBS9338203-03 5x 96 Well

Human Zinc finger protein 493, ZNF493 ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger protein 493, ZNF493 ELISA Kit
MBS9338203-04 10x 96 Well

Human Zinc finger protein 493, ZNF493 ELISA Kit

Sign In for Pricing
View Details