Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psmd10 Rabbit Polyclonal Antibody (Biotin)

Psmd10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gan, AW554874

UniProt

Q9Z2X2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058579

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse WD Repeat Containing Domain Protein 4 (WDR4) ELISA Kit
MBS281575-01 48 Tests

Mouse WD Repeat Containing Domain Protein 4 (WDR4) ELISA Kit

Sign In for Pricing
View Details
Mouse WD Repeat Containing Domain Protein 4 (WDR4) ELISA Kit
MBS281575-02 96 Tests

Mouse WD Repeat Containing Domain Protein 4 (WDR4) ELISA Kit

Sign In for Pricing
View Details
Mouse WD Repeat Containing Domain Protein 4 (WDR4) ELISA Kit
MBS281575-03 5x 96 Tests

Mouse WD Repeat Containing Domain Protein 4 (WDR4) ELISA Kit

Sign In for Pricing
View Details
Mouse WD Repeat Containing Domain Protein 4 (WDR4) ELISA Kit
MBS281575-04 10x 96 Tests

Mouse WD Repeat Containing Domain Protein 4 (WDR4) ELISA Kit

Sign In for Pricing
View Details
GH1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61438R-BF488-01 20 µL

GH1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
GH1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61438R-BF488-02 100 µL

GH1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details