Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Psmd10 Rabbit Polyclonal Antibody (Biotin)

Psmd10 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Gan, AW554874

UniProt

Q9Z2X2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: KERILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDA

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_058579

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CGRP (4901) AC
sc-57053 AC 500 µg/mL - 25% ag

CGRP (4901) AC

Sign In for Pricing
View Details
PSCDBP Polyclonal Antibody, HRP Conjugated
bs-11062R-HRP 100 µL

PSCDBP Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
PPIAP19 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV741340 1.0 µg DNA

PPIAP19 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Ptrh1 (NM_178595) Mouse Untagged Clone
MC214556 10 µg

Ptrh1 (NM_178595) Mouse Untagged Clone

Sign In for Pricing
View Details
AMBP, NT (AMBP, HCP, ITIL, Protein AMBP, Alpha-1-microglobulin, Alpha-1 microglycoprotein, Complex-forming glycoprotein heterogeneous in charge, Inter-alpha-trypsin inhibitor light chain, Bikunin, EDC1, HI-30, Uronic-acid-rich protein, Trypstatin) (MaxLight 650) discontinued
031826-ML650 100 µL

AMBP, NT (AMBP, HCP, ITIL, Protein AMBP, Alpha-1-microglobulin, Alpha-1 microglycoprotein, Complex-forming glycoprotein heterogeneous in charge, Inter-alpha-trypsin inhibitor light chain, Bikunin, EDC1, HI-30, Uronic-acid-rich protein, Trypstatin) (MaxLight 650) discontinued

Sign In for Pricing
View Details
MTCH2 Rabbit Polyclonal Antibody
orb629008-01 50 µg

MTCH2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details