Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMD10 Rabbit Polyclonal Antibody (HRP)

PSMD10 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P28, p28 (GANK), dJ889N15.2

UniProt

O75832

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PSMD10

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLV

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002805

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sodium 2-methoxy-2,3,3,3-tetrafluoropropionate
PC108207 1 Each

Sodium 2-methoxy-2,3,3,3-tetrafluoropropionate

Sign In for Pricing
View Details
KLb (Klotho Beta, Klotho beta-like protein)
363840 200 µL

KLb (Klotho Beta, Klotho beta-like protein)

Sign In for Pricing
View Details
Immortalized Human Hepatocytes - Ras
T0059 1x 10^6 Cells - 1.0 mL

Immortalized Human Hepatocytes - Ras

Sign In for Pricing
View Details
ARHGAP27 Protein Vector (Rat) (pPM-C-His)
PV254369 500 ng

ARHGAP27 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Human OTUD3 knockout cell line
ABC-KH10986 1 Vial

Human OTUD3 knockout cell line

Sign In for Pricing
View Details
B4galt1 Rat shRNA Plasmid (Locus ID 24390)
TR711729 1 Kit

B4galt1 Rat shRNA Plasmid (Locus ID 24390)

Sign In for Pricing
View Details