Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Twf1 Rabbit Polyclonal Antibody (HRP)

Twf1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ptk9

UniProt

Q5RJR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKLSKRQLNYVQLEIDIKNETIILANTENTELKDLPKRIPKDSARYHFFL

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001008521

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human NRN1L sgRNA gene knockout kit - Lentiviral human NRN1L sgRNA gene knockout kit (100)
GTR15366772 1 Vial

Lentiviral human NRN1L sgRNA gene knockout kit - Lentiviral human NRN1L sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Slc16a10 ORF Vector (Mouse) (pORF)
ORF057438 1.0 µg DNA

Slc16a10 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Rabbit Monoclonal Myosin heavy chain 11 Antibody (MYH11/8185R) [Alexa Fluor 350]
NBP3-24304AF350 0.1 mL

Rabbit Monoclonal Myosin heavy chain 11 Antibody (MYH11/8185R) [Alexa Fluor 350]

Sign In for Pricing
View Details
Human GEMIN2 Pre-designed siRNA Set A
SI006175A 1 Each

Human GEMIN2 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Recombinant Mouse Membrane protein FAM159B (Fam159b) , partial
MBS7101707 Inquire

Recombinant Mouse Membrane protein FAM159B (Fam159b) , partial

Sign In for Pricing
View Details
Hemopexin Rabbit mAb
MBS9470476-01 0.05 mL

Hemopexin Rabbit mAb

Sign In for Pricing
View Details