Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB5B Rabbit Polyclonal Antibody (HRP)

RAB5B Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

P61020

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RAB5B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002859

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-[3- (4-fluorophenyl) -1,2,4-oxadiazol-5-yl]pyrrolidinium chloride
sc-492356 500 mg

2-[3- (4-fluorophenyl) -1,2,4-oxadiazol-5-yl]pyrrolidinium chloride

Sign In for Pricing
View Details
250mL PP Centri Bot w ScrewCap - PK36
431841 36 / PCK

250mL PP Centri Bot w ScrewCap - PK36

Sign In for Pricing
View Details
Lentiviral mouse Mecp2 shRNA (UAS) - Lentiviral mouse Mecp2 shRNA (UAS, GFP) plasmid
GTR15289498 1 Vial

Lentiviral mouse Mecp2 shRNA (UAS) - Lentiviral mouse Mecp2 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lentiviral mouse Alkbh7 shRNA (UAS) - Lentiviral mouse Alkbh7 shRNA (UAS) plasmid
GTR15211159 1 Vial

Lentiviral mouse Alkbh7 shRNA (UAS) - Lentiviral mouse Alkbh7 shRNA (UAS) plasmid

Sign In for Pricing
View Details
ELISA Kit For Cartilage acidic protein 1
E7572h 96 Tests

ELISA Kit For Cartilage acidic protein 1

Sign In for Pricing
View Details
GALNTL5, NT (GALNTL5, GALNT15, Putative polypeptide N-acetylgalactosaminyltransferase-like protein 5, Polypeptide GalNAc transferase 15, Protein-UDP acetylgalactosaminyltransferase 15, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 15) (Biotin) discontinued
035902-Biotin 200 µL

GALNTL5, NT (GALNTL5, GALNT15, Putative polypeptide N-acetylgalactosaminyltransferase-like protein 5, Polypeptide GalNAc transferase 15, Protein-UDP acetylgalactosaminyltransferase 15, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 15) (Biotin) discontinued

Sign In for Pricing
View Details