Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRF1 Rabbit Polyclonal Antibody (Biotin)

RASGRF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GNRP, GRF1, CDC25, GRF55, CDC25L, H-GRF55, PP13187, ras-GRF1

UniProt

Q13972

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RASGRF1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

145kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002882

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIX3, ID (SIX3, Homeobox protein SIX3, Sine oculis homeobox homolog 3) (MaxLight 490)
MBS6347874-01 0.1 mL

SIX3, ID (SIX3, Homeobox protein SIX3, Sine oculis homeobox homolog 3) (MaxLight 490)

Sign In for Pricing
View Details
SIX3, ID (SIX3, Homeobox protein SIX3, Sine oculis homeobox homolog 3) (MaxLight 490)
MBS6347874-02 5x 0.1 mL

SIX3, ID (SIX3, Homeobox protein SIX3, Sine oculis homeobox homolog 3) (MaxLight 490)

Sign In for Pricing
View Details
MAPKAPK3 Antibody - C-terminal region : Biotin (ARP60322_P050-Biotin)
ARP60322_P050-Biotin 100 µL

MAPKAPK3 Antibody - C-terminal region : Biotin (ARP60322_P050-Biotin)

Sign In for Pricing
View Details
LT beta R (mouse) monoclonal antibody (5G11)
MBS565068-01 0.1 mg

LT beta R (mouse) monoclonal antibody (5G11)

Sign In for Pricing
View Details
LT beta R (mouse) monoclonal antibody (5G11)
MBS565068-02 5x 0.1 mg

LT beta R (mouse) monoclonal antibody (5G11)

Sign In for Pricing
View Details
Phospho-IRE1 (Ser724) Polyclonal Antibody, APC-Cy7 Conjugated
bs-16698R-APC-Cy7 100 µL

Phospho-IRE1 (Ser724) Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details