Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRF1 Rabbit Polyclonal Antibody (FITC)

RASGRF1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GNRP, GRF1, CDC25, GRF55, CDC25L, H-GRF55, PP13187, ras-GRF1

UniProt

Q13972

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RASGRF1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

145kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002882

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mastoparan 17
MBS659950-01 1 mg

Mastoparan 17

Sign In for Pricing
View Details
Mastoparan 17
MBS659950-02 5x 1 mg

Mastoparan 17

Sign In for Pricing
View Details
Ly49F (Klra6, Killer Cell Lectin-like Receptor, subfamily A, member 6, Killer Cell lectin-like receptor 6, Lymphocyte antigen 49f, T-cell surface glycoprotein Ly-49F)
L7732-25 500 µg

Ly49F (Klra6, Killer Cell Lectin-like Receptor, subfamily A, member 6, Killer Cell lectin-like receptor 6, Lymphocyte antigen 49f, T-cell surface glycoprotein Ly-49F)

Sign In for Pricing
View Details
Vertical Laminar Airflow (BER-3602)
BER-3602 1 Unit

Vertical Laminar Airflow (BER-3602)

Sign In for Pricing
View Details
CGAS monoclonal antibody
MB67150-01 50 µL

CGAS monoclonal antibody

Sign In for Pricing
View Details
CGAS monoclonal antibody
MB67150-02 100 µL

CGAS monoclonal antibody

Sign In for Pricing
View Details