Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRF1 Rabbit Polyclonal Antibody (HRP)

RASGRF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GNRP, GRF1, CDC25, GRF55, CDC25L, H-GRF55, PP13187, ras-GRF1

UniProt

Q13972

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RASGRF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PMSEKGKITRGRLGSLSLKKEGERQCFLFSKHLIICTRGSGGKLHLTKNG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

145kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002882

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse NGF Ready-To-Use IHC Kit
orb2984881 50 Tests

Mouse NGF Ready-To-Use IHC Kit

Sign In for Pricing
View Details
PI3K p85 beta antibody
70R-50211 100 µL

PI3K p85 beta antibody

Sign In for Pricing
View Details
Lentiviral mouse Hoxa2 shRNA (UAS) - Lentiviral mouse Hoxa2 shRNA (UAS, GFP) (100)
GTR15264633 1 Vial

Lentiviral mouse Hoxa2 shRNA (UAS) - Lentiviral mouse Hoxa2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
NAP1L3 polyclonal antibody
orb1787033-01 50 µL

NAP1L3 polyclonal antibody

Sign In for Pricing
View Details
NAP1L3 polyclonal antibody
orb1787033-02 100 µL

NAP1L3 polyclonal antibody

Sign In for Pricing
View Details
NAP1L3 polyclonal antibody
orb1787033-03 200 µL

NAP1L3 polyclonal antibody

Sign In for Pricing
View Details