Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRF1 Rabbit Polyclonal Antibody (HRP)

RASGRF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GNRP, GRF1, CDC25, GRF55, CDC25L, H-GRF55, PP13187, ras-GRF1

UniProt

Q13972

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RASGRF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RELDNNRSALSAASAFAIATAGANEGTPNKEKYRRMSLASAGFPPDQRNG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_722522

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zebrafish VCP Rabbit Polyclonal Antibody (Biotin)
orb2817360 100 µg

Zebrafish VCP Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Human XPNPEP1 Protein
orb429255-01 5 µg

Human XPNPEP1 Protein

Sign In for Pricing
View Details
Human XPNPEP1 Protein
orb429255-02 20 µg

Human XPNPEP1 Protein

Sign In for Pricing
View Details
Human XPNPEP1 Protein
orb429255-03 1 mg

Human XPNPEP1 Protein

Sign In for Pricing
View Details
Human C15orf39 Knockout A549 cell line
GTR15404303 1 Vial

Human C15orf39 Knockout A549 cell line

Sign In for Pricing
View Details
CTNNBL1 Mouse mAb
MBS8539377-01 0.1 mL

CTNNBL1 Mouse mAb

Sign In for Pricing
View Details