Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBBP7 Rabbit Polyclonal Antibody (HRP)

RBBP7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RbAp46

UniProt

Q16576

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTHALQWPSLTVQWLPEVTKPEGKDYALHWLVLGTHTSDEQNHLVVARVH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002884

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM120B Antibody Blocking peptide
orb1454626 500 µg

TMEM120B Antibody Blocking peptide

Sign In for Pricing
View Details
Anzurstobart Biosimilar - Research Grade
ICH5350-25mg 25 mg

Anzurstobart Biosimilar - Research Grade

Sign In for Pricing
View Details
Lentiviral mouse Senp7 shRNA (UAS) - Lentiviral mouse Senp7 shRNA (UAS) plasmid
GTR15131431 1 Vial

Lentiviral mouse Senp7 shRNA (UAS) - Lentiviral mouse Senp7 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Human Keratin-associated protein 4-16 (KR416), Biotinylated
orb3008212-01 20 µg

Recombinant Human Keratin-associated protein 4-16 (KR416), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Keratin-associated protein 4-16 (KR416), Biotinylated
orb3008212-02 100 µg

Recombinant Human Keratin-associated protein 4-16 (KR416), Biotinylated

Sign In for Pricing
View Details
Recombinant Human Keratin-associated protein 4-16 (KR416), Biotinylated
orb3008212-03 1 mg

Recombinant Human Keratin-associated protein 4-16 (KR416), Biotinylated

Sign In for Pricing
View Details