Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBBP7 Rabbit Polyclonal Antibody (HRP)

RBBP7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RbAp46

UniProt

Q16576

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RBBP7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAEDGPPELLFIHGGH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002884

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Proteasome Subunit Beta Type 6 ELISA Kit
MBS104523 Inquire

Goat Proteasome Subunit Beta Type 6 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Dynein Light Chain Roadblock-Type 1
MBS143977-01 0.002 mg

Recombinant Human Dynein Light Chain Roadblock-Type 1

Sign In for Pricing
View Details
Recombinant Human Dynein Light Chain Roadblock-Type 1
MBS143977-02 0.01 mg

Recombinant Human Dynein Light Chain Roadblock-Type 1

Sign In for Pricing
View Details
Recombinant Human Dynein Light Chain Roadblock-Type 1
MBS143977-03 1 mg

Recombinant Human Dynein Light Chain Roadblock-Type 1

Sign In for Pricing
View Details
Recombinant Human Dynein Light Chain Roadblock-Type 1
MBS143977-04 5x 1 mg

Recombinant Human Dynein Light Chain Roadblock-Type 1

Sign In for Pricing
View Details
Human Homeobox protein Hox-A3 (HOXA3) ELISA Kit
abx527632 96 Tests

Human Homeobox protein Hox-A3 (HOXA3) ELISA Kit

Sign In for Pricing
View Details