Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rit1 Rabbit Polyclonal Antibody (HRP)

Rit1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RGD1559874

UniProt

D3ZJH4

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rit1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TMQFISHRFPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRD

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001102655

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mtap4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K4961708 1.0 µg DNA

Mtap4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
H PAX9 Expression Lentivirus
LVP629 1x 10^7 IFU/mL - 200 μL

H PAX9 Expression Lentivirus

Sign In for Pricing
View Details
(2S,3R) -3- (Boc-amino) -2-hydroxy-4- (4-nitrophenyl) butyric acid
sc-283518 5 mg

(2S,3R) -3- (Boc-amino) -2-hydroxy-4- (4-nitrophenyl) butyric acid

Sign In for Pricing
View Details
CCDC136 Antibody Blocking peptide
orb1454064 500 µg

CCDC136 Antibody Blocking peptide

Sign In for Pricing
View Details
Magic™ Membrane Protein Human HLA-B (Major histocompatibility complex, class I, B) for Antibody Discovery
MP0509X Each

Magic™ Membrane Protein Human HLA-B (Major histocompatibility complex, class I, B) for Antibody Discovery

Sign In for Pricing
View Details
Recoverin, ID (Cancer-associated Retinopathy Protein, Protein CAR, RCVRN, RCV1) (MaxLight 550)
MBS6497136-01 0.1 mL

Recoverin, ID (Cancer-associated Retinopathy Protein, Protein CAR, RCVRN, RCV1) (MaxLight 550)

Sign In for Pricing
View Details