Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A5 Rabbit Polyclonal Antibody (FITC)

S100A5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

S100D

UniProt

P33763

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human S10A5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ETPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKKELCLGEMKESS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

10kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PEX2 shRNA (UAS) - Lentiviral human PEX2 shRNA (UAS, iRFP) (25)
GTR15083558 1 Vial

Lentiviral human PEX2 shRNA (UAS) - Lentiviral human PEX2 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Goose Histone Antibody ELISA Kit
MBS039808 Inquire

Goose Histone Antibody ELISA Kit

Sign In for Pricing
View Details
DDO CRISPR Activation Plasmid (h)
sc-411184-ACT 20 µg

DDO CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
DDX58 Recombinant Rabbit mAb
E43S47427 100 µL

DDX58 Recombinant Rabbit mAb

Sign In for Pricing
View Details
Simian S100A6 (S100 Calcium Binding Protein A6) ELISA Kit
ELK11578-01 48 Tests

Simian S100A6 (S100 Calcium Binding Protein A6) ELISA Kit

Sign In for Pricing
View Details
Simian S100A6 (S100 Calcium Binding Protein A6) ELISA Kit
ELK11578-02 96 Tests

Simian S100A6 (S100 Calcium Binding Protein A6) ELISA Kit

Sign In for Pricing
View Details