Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100a5 Rabbit Polyclonal Antibody (Biotin)

S100a5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

S100D, S100D9

UniProt

Q149U2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035442

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRTOMT (NM_001145310) Human Tagged ORF Clone
RG226675 10 µg

LRTOMT (NM_001145310) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit Oncostatin M Receptor (OSMR) ELISA Kit
MBS2611594-01 48 Well

Rabbit Oncostatin M Receptor (OSMR) ELISA Kit

Sign In for Pricing
View Details
Rabbit Oncostatin M Receptor (OSMR) ELISA Kit
MBS2611594-02 96 Well

Rabbit Oncostatin M Receptor (OSMR) ELISA Kit

Sign In for Pricing
View Details
Rabbit Oncostatin M Receptor (OSMR) ELISA Kit
MBS2611594-03 5x 96 Well

Rabbit Oncostatin M Receptor (OSMR) ELISA Kit

Sign In for Pricing
View Details
Rabbit Oncostatin M Receptor (OSMR) ELISA Kit
MBS2611594-04 10x 96 Well

Rabbit Oncostatin M Receptor (OSMR) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal CD31/PECAM-1 Antibody (TLD-3A12) [Alexa Fluor 488]
NB100-64796AF488 0.25 mL

Mouse Monoclonal CD31/PECAM-1 Antibody (TLD-3A12) [Alexa Fluor 488]

Sign In for Pricing
View Details