Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100a5 Rabbit Polyclonal Antibody (HRP)

S100a5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

S100D, S100D9

UniProt

Q149U2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SLAEKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

11kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_035442

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (Methylsulfamoyl) acetic acid
SRB58372-01 100 mg

2- (Methylsulfamoyl) acetic acid

Sign In for Pricing
View Details
2- (Methylsulfamoyl) acetic acid
SRB58372-02 1 g

2- (Methylsulfamoyl) acetic acid

Sign In for Pricing
View Details
Iso-Gold™ Rapid Human Antibody Isotyping Kit, 10 tests
HISOT-010 10 Tests

Iso-Gold™ Rapid Human Antibody Isotyping Kit, 10 tests

Sign In for Pricing
View Details
Goat Thrombospondin 2 (THBS2) ELISA kit
GTR10443485 96 Well

Goat Thrombospondin 2 (THBS2) ELISA kit

Sign In for Pricing
View Details
KEAP1 Antibody (HRP)
orb350543-01 50 µg

KEAP1 Antibody (HRP)

Sign In for Pricing
View Details
KEAP1 Antibody (HRP)
orb350543-02 100 µg

KEAP1 Antibody (HRP)

Sign In for Pricing
View Details