Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sh3gl3 Rabbit Polyclonal Antibody (FITC)

Sh3gl3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SH3P, EEN-B, Sh3d2, EEN-B2, SH3P13, Sh3d2c, Sh3d2c2

UniProt

Q62421

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: IDPLQLLQDKDLKEIGHHLRKLEGRRLDYDYKKRRVGKIPEEEIRQAVEK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_059096

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trypticasein Soy Broth (TSB) 6 x 200 ml Bottles
TMB_TSB_F200_6 6 x 200 mL Bottles

Trypticasein Soy Broth (TSB) 6 x 200 ml Bottles

Sign In for Pricing
View Details
LIN37 Protein Vector (Human) (pPM-C-HA)
PV023771 500 ng

LIN37 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Acetylthio-PEG-NH2, 2K
HE194005-2K Inquire

Acetylthio-PEG-NH2, 2K

Sign In for Pricing
View Details
Lentiviral mouse AI661453 shRNA (UAS) - Lentiviral mouse AI661453 shRNA (UAS, RFP) (100)
GTR15142104 1 Vial

Lentiviral mouse AI661453 shRNA (UAS) - Lentiviral mouse AI661453 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Lentiviral human SGSH shRNA (UAS) - Lentiviral human SGSH shRNA (UAS, iRFP) (100)
GTR15321558 1 Vial

Lentiviral human SGSH shRNA (UAS) - Lentiviral human SGSH shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Phospho-Connexin 43 (Ser368) Rabbit mAb
C05783-20uL 20 µL

Phospho-Connexin 43 (Ser368) Rabbit mAb

Sign In for Pricing
View Details