Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB5A Rabbit Polyclonal Antibody (HRP)

RAB5A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RAB5

UniProt

P20339

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB5A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004153

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Her-2/neu (c-erB-2 Oncoprotein) Rabbit monoclonal Antibody, Ready-To-Use
MAB544P 5 mL

Her-2/neu (c-erB-2 Oncoprotein) Rabbit monoclonal Antibody, Ready-To-Use

Sign In for Pricing
View Details
Slc8a1 (NM_019268) Rat Tagged Lenti ORF Clone
RR205452L4 10 µg

Slc8a1 (NM_019268) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
MINPP1, CT (MINPP1, MIPP, Multiple inositol polyphosphate phosphatase 1, 2,3-bisphosphoglycerate 3-phosphatase, Inositol (1,3,4,5) -tetrakisphosphate 3-phosphatase) (PE) discontinued
038439-PE 200 µL

MINPP1, CT (MINPP1, MIPP, Multiple inositol polyphosphate phosphatase 1, 2,3-bisphosphoglycerate 3-phosphatase, Inositol (1,3,4,5) -tetrakisphosphate 3-phosphatase) (PE) discontinued

Sign In for Pricing
View Details
Positive Control Set Antibody (SS-a, SS-b, Sm, RNP, Scl-70, Jo-1)
GWB-T00081 1 Set

Positive Control Set Antibody (SS-a, SS-b, Sm, RNP, Scl-70, Jo-1)

Sign In for Pricing
View Details
Rxfp2 (NM_001012475) Rat Tagged ORF Clone Lentiviral Particle
RR204919L3V 200 µL

Rxfp2 (NM_001012475) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FBXO27 (F-box Only Protein 27, F-box/G-domain Protein 5, FBG5, FBX27) (HRP)
126678-HRP 100 µL

FBXO27 (F-box Only Protein 27, F-box/G-domain Protein 5, FBG5, FBX27) (HRP)

Sign In for Pricing
View Details