Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab27a Rabbit Polyclonal Antibody (FITC)

Rab27a Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ash, 2210402C08Rik, 2410003M20Rik, 4933437C11Rik

UniProt

Q9ERI2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076124

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Troponin I Type 1 (slow skeletal) Antibody (7G2) [DyLight 405]
NB200-432V 0.2 mL

Mouse Monoclonal Troponin I Type 1 (slow skeletal) Antibody (7G2) [DyLight 405]

Sign In for Pricing
View Details
Recombinant Rat ACTB Protein
orb3068373-01 10 µg

Recombinant Rat ACTB Protein

Sign In for Pricing
View Details
Recombinant Rat ACTB Protein
orb3068373-02 50 µg

Recombinant Rat ACTB Protein

Sign In for Pricing
View Details
Recombinant Rat ACTB Protein
orb3068373-03 500 µg

Recombinant Rat ACTB Protein

Sign In for Pricing
View Details
Recombinant Meyerozyma guilliermondii Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)
MBS1245566 Inquire

Recombinant Meyerozyma guilliermondii Altered inheritance of mitochondria protein 31, mitochondrial (AIM31)

Sign In for Pricing
View Details
GNB1 Peptide
orb2013282 100 µg

GNB1 Peptide

Sign In for Pricing
View Details