Rab27a Rabbit Polyclonal Antibody (HRP)
Rab27a Rabbit Polyclonal Antibody (HRP)
Product Specifications
Product Name Alternative
Ash, 2210402C08Rik, 2410003M20Rik, 4933437C11Rik
UniProt
Q9ERI2
Clonality
Polyclonal
Conjugation
HRP
Sequence
Synthetic peptide located within the following region: DAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ
Field of Research
Signal Transduction
Purification
Affinity Purified
Form
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Molecular Weight
24kDa
Storage Conditions
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Notes
For research use only.
Prediction Reactivity
Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Tested Applications
WB
NCBI Accession Number
NP_076124
Host or Source
Rabbit
Preservative
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6395959-01 0.1 mL
TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) (MaxLight 750)
Sign In for Pricing
View Details MBS6395959-02 5x 0.1 mL
TAF7 (TAF2F, TAFII55, Transcription Initiation Factor TFIID Subunit 7, RNA Polymerase II TBP-associated Factor Subunit F, Transcription Initiation Factor TFIID 55kD Subunit, TAF(II)55, TAFII-55) (MaxLight 750)
Sign In for Pricing
View Details 
orb2667168-01 48 Tests
Chicken Mannose Binding Lectin (MBL) ELISA Kit
Sign In for Pricing
View Details orb2667168-02 96 Tests
Chicken Mannose Binding Lectin (MBL) ELISA Kit
Sign In for Pricing
View Details 
MBS6336353-01 0.1 mL
PPIL6, NT (PPIL6, Peptidyl-prolyl cis-trans isomerase-like 6, Cyclophilin-like protein PPIL6, Rotamase PPIL6) (MaxLight 550)
Sign In for Pricing
View Details