Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab27a Rabbit Polyclonal Antibody (HRP)

Rab27a Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ash, 2210402C08Rik, 2410003M20Rik, 4933437C11Rik

UniProt

Q9ERI2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVLCGNKSDLEDQ

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_076124

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RBMY1D, CT (RBMY1D, RNA-binding motif protein, Y chromosome, family 1 member D)
040908 200 µL

RBMY1D, CT (RBMY1D, RNA-binding motif protein, Y chromosome, family 1 member D)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Uncharacterized protein HI_0650 (HI_0650)
MBS7037798-01 0.02 mg

Recombinant Haemophilus influenzae Uncharacterized protein HI_0650 (HI_0650)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Uncharacterized protein HI_0650 (HI_0650)
MBS7037798-02 0.1 mg

Recombinant Haemophilus influenzae Uncharacterized protein HI_0650 (HI_0650)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae Uncharacterized protein HI_0650 (HI_0650)
MBS7037798-03 5x 0.1 mg

Recombinant Haemophilus influenzae Uncharacterized protein HI_0650 (HI_0650)

Sign In for Pricing
View Details
Bis-Mal-Lysine-PEG4-TFP ester
T14624-01 100 mg

Bis-Mal-Lysine-PEG4-TFP ester

Sign In for Pricing
View Details
Bis-Mal-Lysine-PEG4-TFP ester
T14624-02 500 mg

Bis-Mal-Lysine-PEG4-TFP ester

Sign In for Pricing
View Details