Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rab27b Rabbit Polyclonal Antibody (FITC)

Rab27b Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

2310021G14Rik, B130064M09Rik

UniProt

Q99P58

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: YCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_085031

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Klhdc2 3'UTR Luciferase Stable Cell Line
TU110619 1.0 mL

Klhdc2 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Tbk1, NT (Tbk1, Serine/threonine-protein kinase TBK1, T2K, TANK-binding kinase 1) (AP)
MBS6354073-01 0.2 mL

Tbk1, NT (Tbk1, Serine/threonine-protein kinase TBK1, T2K, TANK-binding kinase 1) (AP)

Sign In for Pricing
View Details
Tbk1, NT (Tbk1, Serine/threonine-protein kinase TBK1, T2K, TANK-binding kinase 1) (AP)
MBS6354073-02 5x 0.2 mL

Tbk1, NT (Tbk1, Serine/threonine-protein kinase TBK1, T2K, TANK-binding kinase 1) (AP)

Sign In for Pricing
View Details
ATP6V1G2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2549158 100 µL

ATP6V1G2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
FXYD1 polyclonal antibody
BS72527-01 50 µL

FXYD1 polyclonal antibody

Sign In for Pricing
View Details
FXYD1 polyclonal antibody
BS72527-02 100 µL

FXYD1 polyclonal antibody

Sign In for Pricing
View Details