Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFS3 Rabbit Polyclonal Antibody (Biotin)

NDUFS3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CI-30, MC1DN8

UniProt

O75489

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NDUFS3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004542

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP5K Protein Vector (Mouse) (pPM-C-HA)
PV191892 500 ng

INPP5K Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Rabbit Anti-Mouse Somatostatin (SST) Polyclonal Antibody
VD1N155 1 Each

Rabbit Anti-Mouse Somatostatin (SST) Polyclonal Antibody

Sign In for Pricing
View Details
Bovine Heat Shock Protein 72 (HSP72) ELISA Kit
MBS9348742-01 48 Well

Bovine Heat Shock Protein 72 (HSP72) ELISA Kit

Sign In for Pricing
View Details
Bovine Heat Shock Protein 72 (HSP72) ELISA Kit
MBS9348742-02 96 Well

Bovine Heat Shock Protein 72 (HSP72) ELISA Kit

Sign In for Pricing
View Details
Bovine Heat Shock Protein 72 (HSP72) ELISA Kit
MBS9348742-03 5x 96 Well

Bovine Heat Shock Protein 72 (HSP72) ELISA Kit

Sign In for Pricing
View Details
Bovine Heat Shock Protein 72 (HSP72) ELISA Kit
MBS9348742-04 10x 96 Well

Bovine Heat Shock Protein 72 (HSP72) ELISA Kit

Sign In for Pricing
View Details