Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFS3 Rabbit Polyclonal Antibody (HRP)

NDUFS3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CI-30, MC1DN8

UniProt

O75489

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NDUFS3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EVKRVVAEPVELAQEFRKFDLNSPWEAFPVYRQPPESLKLEAGDKKPDAK

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

30kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004542

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen Type II
MBS6507309-01 0.1 mg

Collagen Type II

Sign In for Pricing
View Details
Collagen Type II
MBS6507309-02 5x 0.1 mg

Collagen Type II

Sign In for Pricing
View Details
Recombinant ATP synthase subunit c (atpE)
MBS7009066-01 0.02 mg

Recombinant ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
Recombinant ATP synthase subunit c (atpE)
MBS7009066-02 0.1 mg

Recombinant ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
Recombinant ATP synthase subunit c (atpE)
MBS7009066-03 5x 0.1 mg

Recombinant ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
CP110 Rabbit Polyclonal Antibody (Cy5)
orb876394 100 µL

CP110 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details