Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufs6 Rabbit Polyclonal Antibody (FITC)

Ndufs6 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

IP, IP13, BC059730

UniProt

P52503

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AARGFGVQVSPSGEKITHTGQVYDEKDYRRVRFVDRQKEVNENFAIDLIA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_035018

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-GADD45G Antibody Picoband® (PE Conjugate)
A04681-1-PE 100 µg/Vial

Anti-GADD45G Antibody Picoband® (PE Conjugate)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)
orb2937341-01 20 µg

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)
orb2937341-02 100 µg

Recombinant Streptococcus pneumoniae ATP synthase subunit c (atpE)

Sign In for Pricing
View Details
CRBN ligand-253
HY-W953797 1 Each

CRBN ligand-253

Sign In for Pricing
View Details
Recombinant Listeria innocua serovar 6a Aminopeptidase C (pepC)
MBS1292634-01 0.02 mg (E-Coli)

Recombinant Listeria innocua serovar 6a Aminopeptidase C (pepC)

Sign In for Pricing
View Details
Recombinant Listeria innocua serovar 6a Aminopeptidase C (pepC)
MBS1292634-02 0.02 mg (Yeast)

Recombinant Listeria innocua serovar 6a Aminopeptidase C (pepC)

Sign In for Pricing
View Details