Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFKFB4 Rabbit Polyclonal Antibody (Biotin)

PFKFB4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q16877

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PFKFB4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_004558

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFCAB7 Knockout HEK293T Polyclonal Cells
ARG40620 1 Million

EFCAB7 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Apolipoprotein A5
545205 200 µL

Apolipoprotein A5

Sign In for Pricing
View Details
CD63 Antibody / LAMP-3
V8252SAF-100UG 100 µg

CD63 Antibody / LAMP-3

Sign In for Pricing
View Details
LOC100362069 3'UTR Luciferase Stable Cell Line
TU208208 1.0 mL

LOC100362069 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
HSP70 (Heat Shock Protein 70, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A, HSPA1A) (APC)
MBS6188027-01 0.1 mL

HSP70 (Heat Shock Protein 70, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A, HSPA1A) (APC)

Sign In for Pricing
View Details
HSP70 (Heat Shock Protein 70, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A, HSPA1A) (APC)
MBS6188027-02 5x 0.1 mL

HSP70 (Heat Shock Protein 70, HSP72, HSPA1, HSP70I, HSP70-1, HSP70-1A, HSPA1A) (APC)

Sign In for Pricing
View Details