Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB27A Rabbit Polyclonal Antibody (HRP)

RAB27A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GS2, RAM, RAB27, HsT18676

UniProt

P51159

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB27A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Human, Mouse, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_004571

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

West Nile Virus, Matrix (West Nile Virus Matrix Protein, WNV Matrix Protein, West Nile Virus Small Envelope Protein M)
W1018-52G 100 µg

West Nile Virus, Matrix (West Nile Virus Matrix Protein, WNV Matrix Protein, West Nile Virus Small Envelope Protein M)

Sign In for Pricing
View Details
HTR7 Polyclonal Antibody
E55A02533 100 µg

HTR7 Polyclonal Antibody

Sign In for Pricing
View Details
Histone H2B discontinued
343756-01 100 µL

Histone H2B discontinued

Sign In for Pricing
View Details
Histone H2B discontinued
343756-02 200 µL

Histone H2B discontinued

Sign In for Pricing
View Details
Mouse Fc gamma RIII (CD16) (NP_034318) VersaClone cDNA
RDC1432 10 µg

Mouse Fc gamma RIII (CD16) (NP_034318) VersaClone cDNA

Sign In for Pricing
View Details
AP2S1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0100805 3x 1.0 µg

AP2S1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details