Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB27A Rabbit Polyclonal Antibody (HRP)

RAB27A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GS2, RAM, RAB27, HsT18676

UniProt

P51159

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB27A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Goat, Human, Mouse, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_004571

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACVR1 (Activin Receptor Type-1, Activin Receptor Type I, ACTR-I, Activin Receptor-like Kinase 2, ALK-2, Serine/Threonine-protein Kinase Receptor R1, SKR1, TGF-B Superfamily Receptor Type I, TSR-I, ACVRLK2)
A0855-95F 100 µg

ACVR1 (Activin Receptor Type-1, Activin Receptor Type I, ACTR-I, Activin Receptor-like Kinase 2, ALK-2, Serine/Threonine-protein Kinase Receptor R1, SKR1, TGF-B Superfamily Receptor Type I, TSR-I, ACVRLK2)

Sign In for Pricing
View Details
LIG3 Antibody
orb2682273-01 50 µL

LIG3 Antibody

Sign In for Pricing
View Details
LIG3 Antibody
orb2682273-02 100 µL

LIG3 Antibody

Sign In for Pricing
View Details
LIG3 Antibody
orb2682273-03 200 µL

LIG3 Antibody

Sign In for Pricing
View Details
Goat Anti-Human IgG F (ab') 2 - Alexa Fluor 568
DL87353A-01 100 µL

Goat Anti-Human IgG F (ab') 2 - Alexa Fluor 568

Sign In for Pricing
View Details
Goat Anti-Human IgG F (ab') 2 - Alexa Fluor 568
DL87353A-02 500 µL

Goat Anti-Human IgG F (ab') 2 - Alexa Fluor 568

Sign In for Pricing
View Details