Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYBPH Rabbit Polyclonal Antibody (FITC)

MYBPH Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q13203

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MYBPH

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004988

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STON2 ORF Vector (Human) (pORF)
ORF010160 1.0 µg DNA

STON2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Phospho-STAT3 (Tyr705) Rabbit Polyclonal Antibody (PE-Cy5.5)
orb2449322 100 µL

Phospho-STAT3 (Tyr705) Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
THAP5 ORF Vector (Human) (pORF)
ORF010485 1.0 µg DNA

THAP5 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Mannose Receptor C Type 1 ELISA Kit
MBS103505-01 48 Well

Mouse Mannose Receptor C Type 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Mannose Receptor C Type 1 ELISA Kit
MBS103505-02 96 Well

Mouse Mannose Receptor C Type 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Mannose Receptor C Type 1 ELISA Kit
MBS103505-03 5x 96 Well

Mouse Mannose Receptor C Type 1 ELISA Kit

Sign In for Pricing
View Details