Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYBPH Rabbit Polyclonal Antibody (FITC)

MYBPH Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q13203

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MYBPH

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004988

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC Class 1, HLA E (APC)
M3886-06-APC 100 µL

MHC Class 1, HLA E (APC)

Sign In for Pricing
View Details
LONRF1 (LON Peptidase N-terminal Domain and RING Finger Protein 1, RING Finger Protein 191, RNF191, FLJ23749) (MaxLight 650)
126868-ML650 100 µL

LONRF1 (LON Peptidase N-terminal Domain and RING Finger Protein 1, RING Finger Protein 191, RNF191, FLJ23749) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Human UBE2L6 Protein, N-His
orb2962943-01 50 µg

Recombinant Human UBE2L6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human UBE2L6 Protein, N-His
orb2962943-02 100 µg

Recombinant Human UBE2L6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human UBE2L6 Protein, N-His
orb2962943-03 1 mg

Recombinant Human UBE2L6 Protein, N-His

Sign In for Pricing
View Details
Recombinant Humicola lanuginosa LIP/Lipase Protein, C-His
JN077011-01 50 µg

Recombinant Humicola lanuginosa LIP/Lipase Protein, C-His

Sign In for Pricing
View Details