Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufs1 Rabbit Polyclonal Antibody (FITC)

Ndufs1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q66HF1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ndufs1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005550

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm129 CRISPR Activation Plasmid (m2)
sc-432877-ACT-2 20 µg

Gm129 CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
SYT7, NT (SYT7, PCANAP7, Synaptotagmin-7, IPCA-7, Prostate cancer-associated protein 7, Synaptotagmin VII) (Azide free) (HRP)
MBS6353054-01 0.2 mL

SYT7, NT (SYT7, PCANAP7, Synaptotagmin-7, IPCA-7, Prostate cancer-associated protein 7, Synaptotagmin VII) (Azide free) (HRP)

Sign In for Pricing
View Details
SYT7, NT (SYT7, PCANAP7, Synaptotagmin-7, IPCA-7, Prostate cancer-associated protein 7, Synaptotagmin VII) (Azide free) (HRP)
MBS6353054-02 5x 0.2 mL

SYT7, NT (SYT7, PCANAP7, Synaptotagmin-7, IPCA-7, Prostate cancer-associated protein 7, Synaptotagmin VII) (Azide free) (HRP)

Sign In for Pricing
View Details
KIF13B Knockout MES-OV Polyclonal Cells
ARG24721 1 Million

KIF13B Knockout MES-OV Polyclonal Cells

Sign In for Pricing
View Details
trans-Communic acid
TBZ1186 unit

trans-Communic acid

Sign In for Pricing
View Details
ICAM2, ID (ICAM2, Intercellular adhesion molecule 2, CD102) (MaxLight 490)
MBS6309074-01 0.1 mL

ICAM2, ID (ICAM2, Intercellular adhesion molecule 2, CD102) (MaxLight 490)

Sign In for Pricing
View Details