Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ndufs1 Rabbit Polyclonal Antibody (HRP)

Ndufs1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q66HF1

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Ndufs1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGEC

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

79kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001005550

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (MaxLight 750)
MBS6231631-01 0.1 mL

ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (MaxLight 750)

Sign In for Pricing
View Details
ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (MaxLight 750)
MBS6231631-02 5x 0.1 mL

ARMCX3 (ALEX3, Armadillo Repeat-containing X-linked Protein 3, ARM Protein Lost in Epithelial Cancers on Chromosome X 3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2) (MaxLight 750)

Sign In for Pricing
View Details
Iopanoic acid 500mg
A17658-500 500 mg

Iopanoic acid 500mg

Sign In for Pricing
View Details
Fluo-8L™, potassium salt
21100-AAT 10x 50 µg

Fluo-8L™, potassium salt

Sign In for Pricing
View Details
COMMD1 Antibody, HRP conjugated
CSB-PA818712LB01HU-01 50 µg

COMMD1 Antibody, HRP conjugated

Sign In for Pricing
View Details
COMMD1 Antibody, HRP conjugated
CSB-PA818712LB01HU-02 100 µg

COMMD1 Antibody, HRP conjugated

Sign In for Pricing
View Details