Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NME4 Rabbit Polyclonal Antibody (HRP)

NME4 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NDPK-D, NM23H4, nm23-H4

UniProt

O00746

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NME4

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSV

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005000

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Wnt3 shRNA (UAS) - Lentiviral mouseWnt3 shRNA (UAS, GFP) (25)
GTR15153068 1 Vial

Lentiviral mouse Wnt3 shRNA (UAS) - Lentiviral mouseWnt3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 1 Receptor Associated Kinase 4 (IRAK4)
TRV-0057523-01 20 µL

Polyclonal Antibody to Interleukin 1 Receptor Associated Kinase 4 (IRAK4)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 1 Receptor Associated Kinase 4 (IRAK4)
TRV-0057523-02 100 µL

Polyclonal Antibody to Interleukin 1 Receptor Associated Kinase 4 (IRAK4)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 1 Receptor Associated Kinase 4 (IRAK4)
TRV-0057523-03 200 µL

Polyclonal Antibody to Interleukin 1 Receptor Associated Kinase 4 (IRAK4)

Sign In for Pricing
View Details
Polyclonal Antibody to Interleukin 1 Receptor Associated Kinase 4 (IRAK4)
TRV-0057523-04 1 mL

Polyclonal Antibody to Interleukin 1 Receptor Associated Kinase 4 (IRAK4)

Sign In for Pricing
View Details
Mouse Monoclonal ADAMTS15 Antibody (561819) [PE]
FAB5149P 0.1 mL

Mouse Monoclonal ADAMTS15 Antibody (561819) [PE]

Sign In for Pricing
View Details