Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDE1C Rabbit Polyclonal Antibody (Biotin)

PDE1C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Hcam3, DFNA74, hCam-3, cam-PDE 1C

UniProt

Q8TAE4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PDE1C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

72kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005011

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XDH Rabbit Polyclonal Antibody (Fluoro647)
orb3112339 100 µg

XDH Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
CD8 Antibody FITC Conjugated
orb1543585 100 µL

CD8 Antibody FITC Conjugated

Sign In for Pricing
View Details
Cyclin D1 Protein (N-His, Human)
P514662 100 µg

Cyclin D1 Protein (N-His, Human)

Sign In for Pricing
View Details
Polyclonal Antibody to Protein Kinase C Epsilon (PKCe)
TRV-0040115-01 20 µL

Polyclonal Antibody to Protein Kinase C Epsilon (PKCe)

Sign In for Pricing
View Details
Polyclonal Antibody to Protein Kinase C Epsilon (PKCe)
TRV-0040115-02 100 µL

Polyclonal Antibody to Protein Kinase C Epsilon (PKCe)

Sign In for Pricing
View Details
Polyclonal Antibody to Protein Kinase C Epsilon (PKCe)
TRV-0040115-03 200 µL

Polyclonal Antibody to Protein Kinase C Epsilon (PKCe)

Sign In for Pricing
View Details