Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLS3 Rabbit Polyclonal Antibody (Biotin)

PLS3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BMND18, T-plastin

UniProt

P13797

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PLS3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: RRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTSIQSFKDKTISSS

Field of Research

Musculoskeletal & Connective Tissue Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_005023

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CSNK1G2 Antibody
orb1331816 100 µg

CSNK1G2 Antibody

Sign In for Pricing
View Details
NPPC (C-type natriuretic peptide) BioAssayTM ELISA Kit (Mouse) discontinued
357675-01 48 Tests

NPPC (C-type natriuretic peptide) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
NPPC (C-type natriuretic peptide) BioAssayTM ELISA Kit (Mouse) discontinued
357675-02 96 Tests

NPPC (C-type natriuretic peptide) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
DAZL (Deleted in Azoospermia-Like, DAZH, DAZL1, DAZLA, MGC26406, SPGYLA) (Biotin)
MBS6413595-01 0.1 mL

DAZL (Deleted in Azoospermia-Like, DAZH, DAZL1, DAZLA, MGC26406, SPGYLA) (Biotin)

Sign In for Pricing
View Details
DAZL (Deleted in Azoospermia-Like, DAZH, DAZL1, DAZLA, MGC26406, SPGYLA) (Biotin)
MBS6413595-02 5x 0.1 mL

DAZL (Deleted in Azoospermia-Like, DAZH, DAZL1, DAZLA, MGC26406, SPGYLA) (Biotin)

Sign In for Pricing
View Details
TIMM23B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
46714111 3x 1.0 µg

TIMM23B sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details