Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prkab2 Rabbit Polyclonal Antibody (Biotin)

Prkab2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MGC93432

UniProt

Q9QZH4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HKIMVGSTDDPSVFSLPDSKLPGDKEFVPWQQDLDDSVKPTQQARPTVIR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_072149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP3K1 Protein Vector (Human) (pPB-C-His)
PV093118 500 ng

MAP3K1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral human KCNG4 shRNA (UAS) - Lentiviral human KCNG4 shRNA (UAS, GFP) (100)
GTR15081045 1 Vial

Lentiviral human KCNG4 shRNA (UAS) - Lentiviral human KCNG4 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
RNF165 Rabbit Polyclonal Antibody (BF555)
orb2377866 100 µL

RNF165 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
GABARAPL2 (F77) (GATE16, GABA (A) receptor-associated protein-like 2, Ganglioside expression factor 2, GEF-2, General protein transport factor p16, MAP1 light chain 3-related protein)
035841 200 µL

GABARAPL2 (F77) (GATE16, GABA (A) receptor-associated protein-like 2, Ganglioside expression factor 2, GEF-2, General protein transport factor p16, MAP1 light chain 3-related protein)

Sign In for Pricing
View Details
Chicken basic fibroblast growth factor, bFGF ELISA Kit
CSB-E09871Ch-01 24 Well

Chicken basic fibroblast growth factor, bFGF ELISA Kit

Sign In for Pricing
View Details
Chicken basic fibroblast growth factor, bFGF ELISA Kit
CSB-E09871Ch-02 96 Well

Chicken basic fibroblast growth factor, bFGF ELISA Kit

Sign In for Pricing
View Details