Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTPN14 Rabbit Polyclonal Antibody (FITC)

PTPN14 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PEZ, PTP36, PTPD2, CATLPH

UniProt

Q15678

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of mouse PTPN14

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HVQCSEHYSETHTSQDSIFPGNEEALYCRSHNSLDLNYLNGTVTNGSVCS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005392.2

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat LIM and Senescent Cell Antigen-Like-Containing Domain Protein 1 (LIMS1) ELISA Kit
MBS9396852-01 48 Well

Rat LIM and Senescent Cell Antigen-Like-Containing Domain Protein 1 (LIMS1) ELISA Kit

Sign In for Pricing
View Details
Rat LIM and Senescent Cell Antigen-Like-Containing Domain Protein 1 (LIMS1) ELISA Kit
MBS9396852-02 96 Well

Rat LIM and Senescent Cell Antigen-Like-Containing Domain Protein 1 (LIMS1) ELISA Kit

Sign In for Pricing
View Details
Rat LIM and Senescent Cell Antigen-Like-Containing Domain Protein 1 (LIMS1) ELISA Kit
MBS9396852-03 5x 96 Well

Rat LIM and Senescent Cell Antigen-Like-Containing Domain Protein 1 (LIMS1) ELISA Kit

Sign In for Pricing
View Details
Rat LIM and Senescent Cell Antigen-Like-Containing Domain Protein 1 (LIMS1) ELISA Kit
MBS9396852-04 10x 96 Well

Rat LIM and Senescent Cell Antigen-Like-Containing Domain Protein 1 (LIMS1) ELISA Kit

Sign In for Pricing
View Details
PCNA (Cyclin, DNA polymerase delta auxiliary Protein, Mutagen-sensitive 209 Protein, PCNAR, Polymerase delta accessory Protein) (BSA & Azide Free) (MaxLight 650)
MBS6226050-01 0.1 mL

PCNA (Cyclin, DNA polymerase delta auxiliary Protein, Mutagen-sensitive 209 Protein, PCNAR, Polymerase delta accessory Protein) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details
PCNA (Cyclin, DNA polymerase delta auxiliary Protein, Mutagen-sensitive 209 Protein, PCNAR, Polymerase delta accessory Protein) (BSA & Azide Free) (MaxLight 650)
MBS6226050-02 5x 0.1 mL

PCNA (Cyclin, DNA polymerase delta auxiliary Protein, Mutagen-sensitive 209 Protein, PCNAR, Polymerase delta accessory Protein) (BSA & Azide Free) (MaxLight 650)

Sign In for Pricing
View Details