Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rala Rabbit Polyclonal Antibody (Biotin)

Rala Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

P63322

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Rala

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSY

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_112355

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclophilin E (Cyclophilin 33, CYP33, CYP-33, MGC3736, MGC111222, Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, PPIE, Rotamase E, Rotamase-E) (MaxLight 550)
MBS6211040-01 0.1 mL

Cyclophilin E (Cyclophilin 33, CYP33, CYP-33, MGC3736, MGC111222, Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, PPIE, Rotamase E, Rotamase-E) (MaxLight 550)

Sign In for Pricing
View Details
Cyclophilin E (Cyclophilin 33, CYP33, CYP-33, MGC3736, MGC111222, Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, PPIE, Rotamase E, Rotamase-E) (MaxLight 550)
MBS6211040-02 5x 0.1 mL

Cyclophilin E (Cyclophilin 33, CYP33, CYP-33, MGC3736, MGC111222, Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, PPIE, Rotamase E, Rotamase-E) (MaxLight 550)

Sign In for Pricing
View Details
Mouse Heparan sulfate 6 O sulfotransferase 2 (HS6ST2) ELISA kit
GTR10427951 96 Well

Mouse Heparan sulfate 6 O sulfotransferase 2 (HS6ST2) ELISA kit

Sign In for Pricing
View Details
SOHLH2 Peptide - N-terminal region (AAP72146)
AAP72146-100UG 100 µg

SOHLH2 Peptide - N-terminal region (AAP72146)

Sign In for Pricing
View Details
Mouse Ribonuclease A (RNASEA) ELISA Kit
orb1947104-01 48 Tests

Mouse Ribonuclease A (RNASEA) ELISA Kit

Sign In for Pricing
View Details
Mouse Ribonuclease A (RNASEA) ELISA Kit
orb1947104-02 96 Tests

Mouse Ribonuclease A (RNASEA) ELISA Kit

Sign In for Pricing
View Details