Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBBP4 Rabbit Polyclonal Antibody (FITC)

RBBP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NURF55, RBAP48, lin-53

UniProt

Q09028

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTF (Human) OmniKine™ ELISA Kit
OK-0108 1 Kit

CNTF (Human) OmniKine™ ELISA Kit

Sign In for Pricing
View Details
P4HB Polyclonal Antibody
A52628-050 50 µL

P4HB Polyclonal Antibody

Sign In for Pricing
View Details
Langerin (CD207) Rabbit mAb Antibody
orb1950207-01 50 µL

Langerin (CD207) Rabbit mAb Antibody

Sign In for Pricing
View Details
Langerin (CD207) Rabbit mAb Antibody
orb1950207-02 100 µL

Langerin (CD207) Rabbit mAb Antibody

Sign In for Pricing
View Details
Human A disintegrin and metalloproteinase with thrombospondin motifs 1,ADAMTS1 ELISA KIT
JOT-EK1155Hu-01 96 Well

Human A disintegrin and metalloproteinase with thrombospondin motifs 1,ADAMTS1 ELISA KIT

Sign In for Pricing
View Details
Human A disintegrin and metalloproteinase with thrombospondin motifs 1,ADAMTS1 ELISA KIT
JOT-EK1155Hu-02 48 Well

Human A disintegrin and metalloproteinase with thrombospondin motifs 1,ADAMTS1 ELISA KIT

Sign In for Pricing
View Details