Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RBBP4 Rabbit Polyclonal Antibody (FITC)

RBBP4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NURF55, RBAP48, lin-53

UniProt

Q09028

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RBBP4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005601

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BTBD7 Rabbit Polyclonal Antibody (FITC)
orb4190 100 µL

BTBD7 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Trans-Blot Tank (2 Gels)
50060435 1 Unit

Trans-Blot Tank (2 Gels)

Sign In for Pricing
View Details
Recombinant Treponema Pallidum TP_0248 Protein (aa 24-134)
VAng-Cr1354-500gEcoli 500 µg (E. coli)

Recombinant Treponema Pallidum TP_0248 Protein (aa 24-134)

Sign In for Pricing
View Details
Recombinant Xenopus laevis RDS/peripherin-like protein xRDS36 (rds36)
MBS1202894 Inquire

Recombinant Xenopus laevis RDS/peripherin-like protein xRDS36 (rds36)

Sign In for Pricing
View Details
Rat Cysteine rich secretory protein 2 (CRISP2) ELISA Kit
GTR10369828 96 Well

Rat Cysteine rich secretory protein 2 (CRISP2) ELISA Kit

Sign In for Pricing
View Details
Rabbi! anti-PBK Antibody, Affinity Purified
A302-195A-T 10 µg

Rabbi! anti-PBK Antibody, Affinity Purified

Sign In for Pricing
View Details